PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_013610427.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Brassica
Family MYB
Protein Properties Length: 324aa    MW: 36663.1 Da    PI: 7.462
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_013610427.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding50.54.8e-161462148
                     TSSS-HHHHHHHHHHHHHTTTT.-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGgg.tWktIartmgkgRtlkqcksrwqkyl 48
                     +g+W++eEd +l+d++ ++G+g +W + ++++g++R++k+c++rw++yl
   XP_013610427.1 14 KGPWSPEEDGKLKDYIDKYGTGgNWIALPQKIGLKRCGKSCRLRWLNYL 62
                     79*********************************************97 PP

2Myb_DNA-binding391.9e-1269111246
                      SSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHH CS
  Myb_DNA-binding   2 grWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqk 46 
                      g +++eEd +++++    G++ W+ Ia+ ++ gRt++++k++w++
   XP_013610427.1  69 GGFSEEEDSIILRLYISIGSR-WSIIAAQLP-GRTDNDIKNYWNT 111
                      569******************.*********.***********97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129413.939962IPR017930Myb domain
SuperFamilySSF466898.98E-2711109IPR009057Homeodomain-like
SMARTSM007173.7E-111364IPR001005SANT/Myb domain
PfamPF002498.5E-151462IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.601.0E-231569IPR009057Homeodomain-like
CDDcd001673.53E-81662No hitNo description
PROSITE profilePS5129421.65463117IPR017930Myb domain
SMARTSM007174.2E-1267115IPR001005SANT/Myb domain
PfamPF002494.0E-1169111IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.604.8E-2370117IPR009057Homeodomain-like
CDDcd001678.58E-971113No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 324 aa     Download sequence    Send to blast
MGRAPCCDKA NVKKGPWSPE EDGKLKDYID KYGTGGNWIA LPQKIGLKRC GKSCRLRWLN  60
YLRPNIKHGG FSEEEDSIIL RLYISIGSRW SIIAAQLPGR TDNDIKNYWN TKLKKKLLGR  120
QKQMNCQDSL TDSNENTISN NNNKSPQILS NSALERLQLH MQIQNLQSPF SSFYNNPILW  180
PKFHPLLQNT TTIPDQNAKL ASQESFHPLG VNVHQNNSIK LAEINNGVSP VYSENVEQSQ  240
NPAQGFQPNC GFSQDLQLDN GSKELFLVSN DFEITNSSSW WSEEVELERK TTSSSPWGSA  300
SVLDQTTEGM VMLQDYAQMS YHSM
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A6e-26141177108B-MYB
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAF0628780.0AF062878.1 Arabidopsis thaliana putative transcription factor (MYB36) mRNA, complete cds.
GenBankAK2288180.0AK228818.1 Arabidopsis thaliana mRNA for Myb-related transcription factor-like protein, complete cds, clone: RAFL16-14-A17.
GenBankAY5196400.0AY519640.1 Arabidopsis thaliana MYB transcription factor (At5g57620) mRNA, complete cds.
GenBankBT0303310.0BT030331.1 Arabidopsis thaliana unknown protein (At5g57620) mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_013610427.10.0PREDICTED: transcription factor RAX3-like
SwissprotQ9FKL20.0MYB36_ARATH; Transcription factor MYB36
TrEMBLA0A0D3EC640.0A0A0D3EC64_BRAOL; Uncharacterized protein
STRINGscaffold_802340.10.0(Arabidopsis lyrata)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM78982639
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G57620.11e-178myb domain protein 36